peptides.py is a pure-Python package to compute common descriptors for protein sequences

Related tags

Data Analysispeptides.py
Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] "> 
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

DataHerb 4 Feb 11, 2022
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Andrew Tavis McAllister 35 Jan 4, 2023
Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

Nicolai Haaber Junge 1 Oct 20, 2021
sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

Saiem Gilani 37 Dec 27, 2022
PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022
Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

Corca AI 7 Sep 30, 2022
A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

Rishikesh S 4 Oct 17, 2022
VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

Vevesta 24 Dec 14, 2022
nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

NRG Tech Services 23 Dec 8, 2022
Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

    Example in R:

    > library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides

for hydro in peptides.tables.HYDROPHOBICITY.keys():
    print(hydro)
    table = peptides.tables.HYDROPHOBICITY[hydro]
    peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
  return s1 / s2

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)

  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)

  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)

  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
GitHub Repository
Datashredder is a simple data corruption engine written in python. You can corrupt anything text, images and video.

Datashredder is a simple data corruption engine written in python. You can corrupt anything text, images and video. You can chose the cha

2 Jul 22, 2022
Statistical Rethinking: A Bayesian Course Using CmdStanPy and Plotnine

Statistical Rethinking: A Bayesian Course Using CmdStanPy and Plotnine Intro This repo contains the python/stan version of the Statistical Rethinking

Andrés Suárez 3 Nov 08, 2022
International Space Station data with Python research 🌎

International Space Station data with Python research 🌎 Plotting ISS trajectory, calculating the velocity over the earth and more. Plotting trajector

Facundo Pedaccio 41 Jun 16, 2022
University Challenge 2021 With Python

University Challenge 2021 This repository contains: The TeX file of the technical write-up describing the University / HYPER Challenge 2021 under late

2 Nov 27, 2021
Desafio proposto pela IGTI em seu bootcamp de Cloud Data Engineer

Desafio Modulo 4 - Cloud Data Engineer Bootcamp - IGTI Objetivos Criar infraestrutura como código Utuilizando um cluster Kubernetes na Azure Ingestão

Otacilio Filho 4 Jan 23, 2022
Generate lookml for views from dbt models

dbt2looker Use dbt2looker to generate Looker view files automatically from dbt models. Features Column descriptions synced to looker Dimension for eac

lightdash 126 Dec 28, 2022
pyhsmm MITpyhsmm - Bayesian inference in HSMMs and HMMs. MIT

Bayesian inference in HSMMs and HMMs This is a Python library for approximate unsupervised inference in Bayesian Hidden Markov Models (HMMs) and expli

Matthew Johnson 527 Dec 04, 2022
Udacity - Data Analyst Nanodegree - Project 4 - Wrangle and Analyze Data

WeRateDogs Twitter Data from 2015 to 2017 Udacity - Data Analyst Nanodegree - Project 4 - Wrangle and Analyze Data Table of Contents Introduction Proj

Keenan Cooper 1 Jan 12, 2022
DaCe is a parallel programming framework that takes code in Python/NumPy and other programming languages

aCe - Data-Centric Parallel Programming Decoupling domain science from performance optimization. DaCe is a parallel programming framework that takes c

SPCL 330 Dec 30, 2022
Integrate bus data from a variety of sources (batch processing and real time processing).

Purpose: This is integrate bus data from a variety of sources such as: csv, json api, sensor data ... into Relational Database (batch processing and r

1 Nov 25, 2021
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Andrew Tavis McAllister 35 Jan 04, 2023
scikit-survival is a Python module for survival analysis built on top of scikit-learn.

scikit-survival scikit-survival is a Python module for survival analysis built on top of scikit-learn. It allows doing survival analysis while utilizi

Sebastian Pölsterl 876 Jan 04, 2023
statDistros is a Python library for dealing with various statistical distributions

StatisticalDistributions statDistros statDistros is a Python library for dealing with various statistical distributions. Now it provides various stati

1 Oct 03, 2021
Kennedy Institute of Rheumatology University of Oxford Project November 2019

TradingBot6M Kennedy Institute of Rheumatology University of Oxford Project November 2019 Run Change api.txt to binance api key: https://www.binance.c

Kannan SAR 2 Nov 16, 2021
Analyzing Earth Observation (EO) data is complex and solutions often require custom tailored algorithms.

eo-grow Earth observation framework for scaled-up processing in Python. Analyzing Earth Observation (EO) data is complex and solutions often require c

Sentinel Hub 18 Dec 23, 2022
Data processing with Pandas.

Processing-data-with-python This is a simple example showing how to use Pandas to create a dataframe and the processing data with python. The jupyter

1 Jan 23, 2022
For making Tagtog annotation into csv dataset

tagtog_relation_extraction for making Tagtog annotation into csv dataset How to Use On Tagtog 1. Go to Project Downloads 2. Download all documents,

hyeong 4 Dec 28, 2021
Visions provides an extensible suite of tools to support common data analysis operations

Visions And these visions of data types, they kept us up past the dawn. Visions provides an extensible suite of tools to support common data analysis

168 Dec 28, 2022
A Python and R autograding solution

Otter-Grader Otter Grader is a light-weight, modular open-source autograder developed by the Data Science Education Program at UC Berkeley. It is desi

Infrastructure Team 93 Jan 03, 2023
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022